PDB Chain: 3if5A

Molscript image for 3if5A
3if5A
PDB coordinates for chain 3if5A

PDB 3if5, Chain A

CATH Domains (2)

Domain IDCATH codeImage
3if5A01 Not yet assigned Molscript image for 3if5A01
3if5A02 Not yet assigned Molscript image for 3if5A02

Domain boundaries for PDB chain 3if5A

Chain ATOM Sequence

>pdb|3if5A
MRHPIPDYLASLVTELGAVNPGETAQYIPVLAEADPDRFGIALATPTGRLHCAGDADVEFTIQSASKPFTYAAALVDRGF
AAVDRQVGLNPSGEAFNELSLEAESHRPDNAMINAGALAVHQLLVGPEASRKERLDRAVEIMSLLAGRRLSVDWETYESE
MAVSDRNLSLAHMLRSYGVLQDSAEEIVAGYVAQCAVLVTVKDLAVMGACLATGGIHPMTGERMLPSIVARRVVSVMTSS
GMYDAAGQWLADVGIPAKSGVAGGVLGALPGRVGIGVFSPRLDEVGNSARGVLACRRLSEDFRLHLMDGDSLGGTAVRFV
EREGDRVFLHLQGVIRFGGAEAVLDALTDLRTGIRTVVLNLARVDRIDDVGRRLIAEGVRRLQADGVRVEVEDPERIL    

Chain COMBS Sequence

>pdb|3if5A
MRHPIPDYLASLVTELGAVNPGETAQYIPVLAEADPDRFGIALATPTGRLHCAGDADVEFTIQSASKPFTYAAALVDRGF
AAVDRQVGLNPSGEAFNELSLEAESHRPDNAMINAGALAVHQLLVGPEASRKERLDRAVEIMSLLAGRRLSVDWETYESE
MAVSDRNLSLAHMLRSYGVLQDSAEEIVAGYVAQCAVLVTVKDLAVMGACLATGGIHPMTGERMLPSIVARRVVSVMTSS
GMYDAAGQWLADVGIPAKSGVAGGVLGALPGRVGIGVFSPRLDEVGNSARGVLACRRLSEDFRLHLMDGDSLGGTAVRFV
EREGDRVFLHLQGVIRFGGAEAVLDALTDLRTGIRTVVLNLARVDRIDDVGRRLIAEGVRRLQADGVRVEVEDPERILPL
EEAGAH    

Chain History Events (9)

Flow stage update by auto on 29 Mar 2010 05:34

Final ChopClose added based on similarity with "2dfwA"

Chain chopped by auto on 29 Mar 2010 05:34

Final ChopClose added based on similarity with "2dfwA"

Chain chopping chopclose by auto on 29 Mar 2010 05:34

Putative ChopClose added based on similarity with "2dfwA"

Flow stage update by auto on 29 Mar 2010 04:57

No in_process hits for Chain "3if5A" ready to be processed

Flow stage update by auto on 29 Mar 2010 04:57

NW result present for Chain "3if5A"

Flow stage update by auto on 18 Aug 2009 08:05

All required files are present for Chain "3if5A"

Flow stage update by auto on 17 Aug 2009 01:59

Beginning processing for Chain "3if5A"

Flow stage update by auto on 16 Aug 2009 23:04

Chain passed the SIFT criteria

Insertion by auto on 16 Aug 2009 23:02

Adding chain from chain pdb dir "/cath/data/current/chainpdb"