PDB: 1h99 XML data for PDB: 1h99

Molscript image for 1h99
1h99
PDB coordinates for PDB 1h99

PDB 1h99

CATH Domains (2)

Domain IDChain IDCATH codeImage
1h99A01 1h99A 1.10.1790.10 Molscript image for 1h99A01
1h99A02 1h99A 1.10.1790.10 Molscript image for 1h99A02

Chain: 1h99A

Chopping figure for chain 1h99A

Chain: 1h99A

>pdb|1h99A
GAMEKFKTLLYDIPIECMEVSEEIISYAKLQLGKKLNDSIYVSLTDHINFAIQRNQKGLDIKNALLWETKRLYKDEFAIG
KEALVMVKNKTGVSLPEDEAGFIALHIVNAELNEEMPNIINITKVMEEILSIVKYHFKIEFNEESLHYYRFVTDLKFFAQ
RLFNGTHMESEDDFLLDTVKEKYHRAYECTKKIQTYIEREYEHKLTSDELLYLTIDIERVVKQA